PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0138s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 367aa    MW: 40854.1 Da    PI: 6.5073
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0138s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-141470148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48
                            rg WT+eEd + +  v+++G+g+W++++++           ++R++k+c++rw +yl
  SapurV1A.0138s0120.1.p 14 RGLWTAEEDAKMLAHVAKHGTGNWTSVPKKAAfhkracfagLRRCGKSCRLRWTNYL 70
                            788****************************************************97 PP

2Myb_DNA-binding45.22.1e-1477118245
                             SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
         Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                             +r+T++E+e ++++++  G++ W+ Ia+ ++ gRt++++k++w+
  SapurV1A.0138s0120.1.p  77 DRFTPQEEEMIIRLHAAIGSR-WSIIAQQLP-GRTDNDVKNYWN 118
                             69*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-23573IPR009057Homeodomain-like
PROSITE profilePS5129415.586970IPR017930Myb domain
SuperFamilySSF466891.06E-2812117IPR009057Homeodomain-like
SMARTSM007173.4E-111372IPR001005SANT/Myb domain
PfamPF002499.9E-131470IPR001005SANT/Myb domain
CDDcd001672.66E-91770No hitNo description
PROSITE profilePS5129421.97471125IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2474125IPR009057Homeodomain-like
SMARTSM007174.2E-1375123IPR001005SANT/Myb domain
PfamPF002497.9E-1378118IPR001005SANT/Myb domain
CDDcd001671.09E-978118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MVRPPCCDKS TVKRGLWTAE EDAKMLAHVA KHGTGNWTSV PKKAAFHKRA CFAGLRRCGK  60
SCRLRWTNYL RPDLNHDRFT PQEEEMIIRL HAAIGSRWSI IAQQLPGRTD NDVKNYWNAR  120
LRKKLSEMGI DPVTHKPFSK ILADYGEIGG LLKSGSRIGS LSRDLRNVFT LKPERNLFTP  180
EGISNISSHL MTAEVPPKTE PNRECFLSDK YINGSNQNHS LDLLDQLQAV KLVTEEASSS  240
RTAYQTIPAP CILDEGSSSS STCSTAAQEK LPASFSWCDF LVEDEYLPGD HPQAEQENAA  300
EFSSKNPNAM IPQCVESNVG SVNGMDLALQ SNAGSDDHRT FVEAIIDGES KIFLDFPNLL  360
EEIFYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141257108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042628.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLB9I3280.0B9I328_POPTR; Putative MYB transcription factor family protein
STRINGPOPTR_0012s07450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.17e-69MYB family protein